Lineage for d2a73b3 (2a73 B:651-719)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2327856Fold a.50: Anaphylotoxins (complement system) [47685] (1 superfamily)
    4 helices; irregular array, disulfide-linked
  4. 2327857Superfamily a.50.1: Anaphylotoxins (complement system) [47686] (1 family) (S)
  5. 2327858Family a.50.1.1: Anaphylotoxins (complement system) [47687] (3 proteins)
    can be classified as disulfide-rich
    Pfam PF01821
  6. 2327859Protein C3 ANA (anaphylatoxin) domain [254366] (1 species)
  7. 2327860Species Human (Homo sapiens) [TaxId:9606] [254799] (1 PDB entry)
  8. 2327861Domain d2a73b3: 2a73 B:651-719 [241224]
    Other proteins in same PDB: d2a73.1, d2a73a1, d2a73a2, d2a73a3, d2a73a4, d2a73a5, d2a73a6, d2a73b1, d2a73b2, d2a73b4, d2a73b5, d2a73b6, d2a73b7, d2a73b8

Details for d2a73b3

PDB Entry: 2a73 (more details), 3.3 Å

PDB Description: human complement component c3
PDB Compounds: (B:) Complement C3

SCOPe Domain Sequences for d2a73b3:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a73b3 a.50.1.1 (B:651-719) C3 ANA (anaphylatoxin) domain {Human (Homo sapiens) [TaxId: 9606]}
vqltekrmdkvgkypkelrkccedgmrenpmrfscqrrtrfislgeackkvfldccnyit
elrrqhara

SCOPe Domain Coordinates for d2a73b3:

Click to download the PDB-style file with coordinates for d2a73b3.
(The format of our PDB-style files is described here.)

Timeline for d2a73b3: