Lineage for d2a73a6 (2a73 A:578-643)

  1. Root: SCOPe 2.06
  2. 2256768Class g: Small proteins [56992] (94 folds)
  3. 2265355Fold g.94: Complement C3 linker domain-like [254109] (1 superfamily)
  4. 2265356Superfamily g.94.1: Complement C3 linker domain-like [254128] (1 family) (S)
  5. 2265357Family g.94.1.1: Complement C3 linker domain-like [254162] (2 proteins)
  6. 2265358Protein Complement C3 linker domain [254364] (1 species)
  7. 2265359Species Human (Homo sapiens) [TaxId:9606] [254797] (1 PDB entry)
  8. 2265360Domain d2a73a6: 2a73 A:578-643 [241221]
    Other proteins in same PDB: d2a73.1, d2a73a1, d2a73a2, d2a73a3, d2a73a4, d2a73a5, d2a73b1, d2a73b2, d2a73b3, d2a73b4, d2a73b5, d2a73b6, d2a73b7, d2a73b8

Details for d2a73a6

PDB Entry: 2a73 (more details), 3.3 Å

PDB Description: human complement component c3
PDB Compounds: (A:) Complement C3

SCOPe Domain Sequences for d2a73a6:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a73a6 g.94.1.1 (A:578-643) Complement C3 linker domain {Human (Homo sapiens) [TaxId: 9606]}
kgvfvlnkknkltqskiwdvvekadigctpgsgkdyagvfsdagltftsssgqqtaqrae
lqcpqp

SCOPe Domain Coordinates for d2a73a6:

Click to download the PDB-style file with coordinates for d2a73a6.
(The format of our PDB-style files is described here.)

Timeline for d2a73a6: