Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.29: Macroglobulin [254121] (8 families) C3 MG domains possibly arose by gene duplication according to PubMed 16177781; PubMed 17608619; possibly related to immunoglobulins according to Pfam clan annotations |
Family b.1.29.6: Complement C3 MG5-like [254159] (2 proteins) Pfam PF07703 |
Protein Complement C3 MG5 [254356] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [254789] (1 PDB entry) |
Domain d2a73a5: 2a73 A:426-534 [241220] Other proteins in same PDB: d2a73.1, d2a73a1, d2a73a2, d2a73a3, d2a73a4, d2a73a6, d2a73b1, d2a73b2, d2a73b3, d2a73b4, d2a73b5, d2a73b6, d2a73b7, d2a73b8 |
PDB Entry: 2a73 (more details), 3.3 Å
SCOPe Domain Sequences for d2a73a5:
Sequence; same for both SEQRES and ATOM records: (download)
>d2a73a5 b.1.29.6 (A:426-534) Complement C3 MG5 {Human (Homo sapiens) [TaxId: 9606]} tvgnsnnylhlsvlrtelrpgetlnvnfllrmdraheakiryytylimnkgrllkagrqv repgqdlvvlplsittdfipsfrlvayytligasgqrevvadsvwvdvk
Timeline for d2a73a5: