Lineage for d1bjqf_ (1bjq F:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 555832Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 555833Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (21 families) (S)
  5. 555834Family b.29.1.1: Legume lectins [49900] (4 proteins)
  6. 555962Protein Legume lectin [49904] (23 species)
  7. 556080Species Horse gram (Dolichos biflorus), different isoforms [TaxId:3840] [49915] (5 PDB entries)
  8. 556093Domain d1bjqf_: 1bjq F: [24122]

Details for d1bjqf_

PDB Entry: 1bjq (more details), 2.65 Å

PDB Description: the dolichos biflorus seed lectin in complex with adenine

SCOP Domain Sequences for d1bjqf_:

Sequence, based on SEQRES records: (download)

>d1bjqf_ b.29.1.1 (F:) Legume lectin {Horse gram (Dolichos biflorus), different isoforms}
aniqsfsfknfnspsfilqgdatvssgklqltkvkengiptpsslgrafysspiqiydks
tgavaswatsftvkisapskasfadgiafalvpvgseprrnggylgvfdsdvynnsaqtv
avefdtlsnsgwdpsmkhigidvnsiksiatvswdlangenaeilitynaatsllvaslv
hpsrrtsyilservditnelpeyvsvgfsattglsegyiethdvlswsfasklpd

Sequence, based on observed residues (ATOM records): (download)

>d1bjqf_ b.29.1.1 (F:) Legume lectin {Horse gram (Dolichos biflorus), different isoforms}
aniqsfsfknfnspsfilqgdatvssgklqltkvkengiptpsslgrafysspiqiydks
tgavaswatsftvkisapasfadgiafalvpvgseprrnggylgvfdsdvynnsaqtvav
efdtlsnsgwdpsmkhigidvnsiksiatvswdlangenaeilitynaatsllvaslvhp
srrtsyilservditnelpeyvsvgfsattglsegyiethdvlswsfasklpd

SCOP Domain Coordinates for d1bjqf_:

Click to download the PDB-style file with coordinates for d1bjqf_.
(The format of our PDB-style files is described here.)

Timeline for d1bjqf_: