SCOPe 2.08: Domain d2a63a_: 2a63 A:

Lineage for d2a63a_ (2a63 A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
   core: 4 helices; folded leaf, closed

4. Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families)

5. Family a.35.1.2: Phage repressors [47419] (7 proteins)
   consists of different sequence families of HTH repressors of phage origins

6. Protein cro lambda repressor [47428] (1 species)
   the fourth helix is replaced with a beta hairpin
   3 helices; folded leaf, opened

7. Species Bacteriophage lambda [TaxId:10710] [47429] (12 PDB entries)

8. Domain d2a63a_: 2a63 A: [241214]
   automated match to d1copd_
   mutant
   heterogeneous fold; applies to domains that adopt a different fold than the exemplar domain but has similar sequence and number of secondary structures

Details for d2a63a_

PDB Entry: 2a63

PDB Description: solution structure of a stably monomeric mutant of lambda cro produced by substitutions in the ball-and-socket interface

PDB Compounds: (A:) regulatory protein cro

SCOPe Domain Sequences for d2a63a_:

Sequence; same for both SEQRES and ATOM records:

>d2a63a_ a.35.1.2 (A:) cro lambda repressor {Bacteriophage lambda [TaxId: 10710]}
meqritlkdyamrfgqtktakdlgvqqsainkwihagrkifltinadgsvyaeevkpdps
nkktta

Timeline for d2a63a_:

• d2a63a_ first appeared in SCOPe 2.04
  
• d2a63a_ appears in SCOPe 2.07