Lineage for d2a63a_ (2a63 A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2318756Fold a.35: lambda repressor-like DNA-binding domains [47412] (1 superfamily)
    core: 4 helices; folded leaf, closed
  4. 2318757Superfamily a.35.1: lambda repressor-like DNA-binding domains [47413] (14 families) (S)
  5. 2318778Family a.35.1.2: Phage repressors [47419] (7 proteins)
    consists of different sequence families of HTH repressors of phage origins
  6. 2318798Protein cro lambda repressor [47428] (1 species)
    the fourth helix is replaced with a beta hairpin
    3 helices; folded leaf, opened
  7. 2318799Species Bacteriophage lambda [TaxId:10710] [47429] (12 PDB entries)
  8. 2318816Domain d2a63a_: 2a63 A: [241214]
    automated match to d1copd_
    mutant

Details for d2a63a_

PDB Entry: 2a63 (more details)

PDB Description: Solution structure of a stably monomeric mutant of lambda Cro produced by substitutions in the ball-and-socket interface
PDB Compounds: (A:) regulatory protein cro

SCOPe Domain Sequences for d2a63a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a63a_ a.35.1.2 (A:) cro lambda repressor {Bacteriophage lambda [TaxId: 10710]}
meqritlkdyamrfgqtktakdlgvqqsainkwihagrkifltinadgsvyaeevkpdps
nkktta

SCOPe Domain Coordinates for d2a63a_:

Click to download the PDB-style file with coordinates for d2a63a_.
(The format of our PDB-style files is described here.)

Timeline for d2a63a_: