SCOPe 2.08: Domain d2a5ma2: 2a5m A:91-177

Lineage for d2a5ma2 (2a5m A:91-177)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.11: gamma-Crystallin-like [49694] (1 superfamily)
   sandwich; 8 strands in 2 sheets; greek-key
   duplication: has internal pseudo twofold symmetry

4. Superfamily b.11.1: gamma-Crystallin-like [49695] (7 families)

5. Family b.11.1.1: Crystallins/Ca-binding development proteins [49696] (5 proteins)

6. Protein gamma-Crystallin [49697] (9 species)
   duplication consists of two domains of this fold

7. Species Mouse (Mus musculus) [TaxId:10090] [255018] (5 PDB entries)

8. Domain d2a5ma2: 2a5m A:91-177 [241213]
   automated match to d1amma2

Details for d2a5ma2

PDB Entry: 2a5m

PDB Description: nmr structure of murine gamma-s crystallin from joint refinement with saxs data

PDB Compounds: (A:) gamma crystallin s

SCOPe Domain Sequences for d2a5ma2:

Sequence; same for both SEQRES and ATOM records:

>d2a5ma2 b.11.1.1 (A:91-177) gamma-Crystallin {Mouse (Mus musculus) [TaxId: 10090]}
gqakiqvfekgdfngqmyettedcpsimeqfhlreihsckvvegtwifyelpnyrgrqyl
ldkkeyrkpvdwgaaspaiqsfrrive

Timeline for d2a5ma2:

• d2a5ma2 first appeared in SCOPe 2.04
  
• d2a5ma2 appears in SCOPe 2.07