Lineage for d2a5ma2 (2a5m A:91-177)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2773464Fold b.11: gamma-Crystallin-like [49694] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key
    duplication: has internal pseudo twofold symmetry
  4. 2773465Superfamily b.11.1: gamma-Crystallin-like [49695] (7 families) (S)
  5. 2773466Family b.11.1.1: Crystallins/Ca-binding development proteins [49696] (5 proteins)
  6. 2773504Protein gamma-Crystallin [49697] (9 species)
    duplication consists of two domains of this fold
  7. 2773544Species Mouse (Mus musculus) [TaxId:10090] [255018] (5 PDB entries)
  8. 2773566Domain d2a5ma2: 2a5m A:91-177 [241213]
    automated match to d1amma2

Details for d2a5ma2

PDB Entry: 2a5m (more details)

PDB Description: nmr structure of murine gamma-s crystallin from joint refinement with saxs data
PDB Compounds: (A:) gamma crystallin s

SCOPe Domain Sequences for d2a5ma2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a5ma2 b.11.1.1 (A:91-177) gamma-Crystallin {Mouse (Mus musculus) [TaxId: 10090]}
gqakiqvfekgdfngqmyettedcpsimeqfhlreihsckvvegtwifyelpnyrgrqyl
ldkkeyrkpvdwgaaspaiqsfrrive

SCOPe Domain Coordinates for d2a5ma2:

Click to download the PDB-style file with coordinates for d2a5ma2.
(The format of our PDB-style files is described here.)

Timeline for d2a5ma2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2a5ma1