Lineage for d2a3sa_ (2a3s A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2691777Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 2692959Superfamily a.4.5: 'Winged helix' DNA-binding domain [46785] (86 families) (S)
    contains a small beta-sheet (wing)
  5. 2693299Family a.4.5.14: Forkhead DNA-binding domain [46832] (7 proteins)
  6. 2693320Protein automated matches [190243] (2 species)
    not a true protein
  7. 2693339Species Mouse (Mus musculus) [TaxId:10090] [255024] (2 PDB entries)
  8. 2693341Domain d2a3sa_: 2a3s A: [241211]
    automated match to d1jxsa_

Details for d2a3sa_

PDB Entry: 2a3s (more details)

PDB Description: solution structure and dynamics of dna-binding domain of myocyte nuclear factor
PDB Compounds: (A:) Myocyte Nuclear Factor

SCOPe Domain Sequences for d2a3sa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a3sa_ a.4.5.14 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
eskppysyaqlivqaissaqdrqltlsgiyahitkhypyyrtadkgwqnsirhnlslnry
fikvprsqeepgkgsfwridpaseaklveqafrkrrqrgvs

SCOPe Domain Coordinates for d2a3sa_:

Click to download the PDB-style file with coordinates for d2a3sa_.
(The format of our PDB-style files is described here.)

Timeline for d2a3sa_: