SCOPe 2.04: Domain d2a38c1: 2a38 C:1-100

Lineage for d2a38c1 (2a38 C:1-100)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (19 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (522 PDB entries)

8. Domain d2a38c1: 2a38 C:1-100 [241209]
   automated match to d1g1ca_
   complexed with cd

Details for d2a38c1

PDB Entry: 2a38, 2 Å

PDB Description: Crystal structure of the N-Terminus of titin

PDB Compounds: (C:) titin

SCOPe Domain Sequences for d2a38c1:

Sequence; same for both SEQRES and ATOM records:

>d2a38c1 b.1.1.0 (C:1-100) automated matches {Human (Homo sapiens) [TaxId: 9606]}
mttqaptftqplqsvvvlegstatfeahisgfpvpevswfrdgqviststlpgvqisfsd
grakltipavtkansgryslkatngsgqatstaellvkae

Timeline for d2a38c1:

• d2a38c1 is new in SCOPe 2.04-stable
  
• d2a38c1 appears in SCOPe 2.05
  
• d2a38c1 appears in the current release, SCOPe 2.08