Lineage for d2a38b2 (2a38 B:101-194)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2031996Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2031997Protein automated matches [190740] (28 species)
    not a true protein
  7. 2032126Species Human (Homo sapiens) [TaxId:9606] [187920] (935 PDB entries)
  8. 2032371Domain d2a38b2: 2a38 B:101-194 [241208]
    automated match to d1g1ca_
    complexed with cd

Details for d2a38b2

PDB Entry: 2a38 (more details), 2 Å

PDB Description: Crystal structure of the N-Terminus of titin
PDB Compounds: (B:) titin

SCOPe Domain Sequences for d2a38b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2a38b2 b.1.1.0 (B:101-194) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tappnfvqrlqsmtvrqgsqvrlqvrvtgiptpvvkfyrdgaeiqssldfqisqegdlys
lliaeaypedsgtysvnatnsvgratstaellvq

SCOPe Domain Coordinates for d2a38b2:

Click to download the PDB-style file with coordinates for d2a38b2.
(The format of our PDB-style files is described here.)

Timeline for d2a38b2: