| Class b: All beta proteins [48724] (180 folds) |
| Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.2: SH3-domain [50044] (2 families) ![]() |
| Family b.34.2.1: SH3-domain [50045] (40 proteins) |
| Protein automated matches [190043] (8 species) not a true protein |
| Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [255023] (4 PDB entries) |
| Domain d2a36a_: 2a36 A: [241203] automated match to d1gbra_ |
PDB Entry: 2a36 (more details)
SCOPe Domain Sequences for d2a36a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2a36a_ b.34.2.1 (A:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
meaiakhdfsataddelsfrktqilkilnmeddsnwyraeldgkeglipsnyiemknhd
Timeline for d2a36a_: