SCOPe 2.06: Domain d2a30c_: 2a30 C:

Lineage for d2a30c_ (2a30 C:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins)
   parallel beta-sheet of 5 strands, order 23145

6. Protein Deoxycytidine kinase [89657] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [89658] (45 PDB entries)

8. Domain d2a30c_: 2a30 C: [241201]
   automated match to d1p60a_
   complexed with ca, dcz

Details for d2a30c_

PDB Entry: 2a30, 3.02 Å

PDB Description: Crystal structure of human deoxycytidine kinase in complex with deoxycytidine

PDB Compounds: (C:) Deoxycytidine kinase

SCOPe Domain Sequences for d2a30c_:

Sequence, based on SEQRES records:

>d2a30c_ c.37.1.1 (C:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]}
rikkisiegniaagkstfvnilkqlcedwevvpepvarwcnvqstnvlqmmyekperwsf
tfqtyaclsriraqlaslngklkdaekpvlffersvysdryifasnlyesecmnetewti
yqdwhdwmnnqfgqsleldgiiylqatpetclhriylrgrneeqgipleyleklhykhes
wllhrtlktnfdylqevpiltldvnedfkdkyeslvekvkeflstl

Sequence, based on observed residues (ATOM records):

>d2a30c_ c.37.1.1 (C:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]}
rikkisiegniaagkstfvnilkqlcedwevvpepvarwcnvqstnvlqmmyekperwsf
tfqtyaclsriraqlaslngklkdaekpvlffersvysdryifasnlyesecmnetewti
yqdwhdwmnnqfgqsleldgiiylqatpetclhriylrgrneeqgipleyleklhykhes
wllhrtlktnfdylqevpiltldvneyeslvekvkeflstl

Timeline for d2a30c_:

• d2a30c_ first appeared in SCOPe 2.04
  
• d2a30c_ appears in SCOPe 2.05
  
• d2a30c_ appears in SCOPe 2.07
  
• d2a30c_ appears in the current release, SCOPe 2.08