Lineage for d2a30c_ (2a30 C:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1593542Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1593543Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1593544Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins)
    parallel beta-sheet of 5 strands, order 23145
  6. 1593633Protein Deoxycytidine kinase [89657] (1 species)
  7. 1593634Species Human (Homo sapiens) [TaxId:9606] [89658] (40 PDB entries)
  8. 1593705Domain d2a30c_: 2a30 C: [241201]
    automated match to d1p60a_
    complexed with ca, dcz

Details for d2a30c_

PDB Entry: 2a30 (more details), 3.02 Å

PDB Description: Crystal structure of human deoxycytidine kinase in complex with deoxycytidine
PDB Compounds: (C:) Deoxycytidine kinase

SCOPe Domain Sequences for d2a30c_:

Sequence, based on SEQRES records: (download)

>d2a30c_ c.37.1.1 (C:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]}
rikkisiegniaagkstfvnilkqlcedwevvpepvarwcnvqstnvlqmmyekperwsf
tfqtyaclsriraqlaslngklkdaekpvlffersvysdryifasnlyesecmnetewti
yqdwhdwmnnqfgqsleldgiiylqatpetclhriylrgrneeqgipleyleklhykhes
wllhrtlktnfdylqevpiltldvnedfkdkyeslvekvkeflstl

Sequence, based on observed residues (ATOM records): (download)

>d2a30c_ c.37.1.1 (C:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]}
rikkisiegniaagkstfvnilkqlcedwevvpepvarwcnvqstnvlqmmyekperwsf
tfqtyaclsriraqlaslngklkdaekpvlffersvysdryifasnlyesecmnetewti
yqdwhdwmnnqfgqsleldgiiylqatpetclhriylrgrneeqgipleyleklhykhes
wllhrtlktnfdylqevpiltldvneyeslvekvkeflstl

SCOPe Domain Coordinates for d2a30c_:

Click to download the PDB-style file with coordinates for d2a30c_.
(The format of our PDB-style files is described here.)

Timeline for d2a30c_: