Lineage for d2a2zc_ (2a2z C:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1845072Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1845073Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1845074Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins)
    parallel beta-sheet of 5 strands, order 23145
  6. 1845163Protein Deoxycytidine kinase [89657] (1 species)
  7. 1845164Species Human (Homo sapiens) [TaxId:9606] [89658] (41 PDB entries)
  8. 1845248Domain d2a2zc_: 2a2z C: [241197]
    automated match to d1p60a_
    complexed with ca, dcz, mg, udp

Details for d2a2zc_

PDB Entry: 2a2z (more details), 3.02 Å

PDB Description: Crystal Structure of human deoxycytidine kinase in complex with deoxycytidine and uridine diphosphate
PDB Compounds: (C:) Deoxycytidine kinase

SCOPe Domain Sequences for d2a2zc_:

Sequence, based on SEQRES records: (download)

>d2a2zc_ c.37.1.1 (C:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]}
rikkisiegniaagkstfvnilkqlcedwevvpepvarwcnvqstnvlqmmyekperwsf
tfqtyaclsriraqlaslngklkdaekpvlffersvysdryifasnlyesecmnetewti
yqdwhdwmnnqfgqsleldgiiylqatpetclhriylrgrneeqgipleyleklhykhes
wllhrtlktnfdylqevpiltldvnedfkdkyeslvekvkeflstl

Sequence, based on observed residues (ATOM records): (download)

>d2a2zc_ c.37.1.1 (C:) Deoxycytidine kinase {Human (Homo sapiens) [TaxId: 9606]}
rikkisiegniaagkstfvnilkqlcedwevvpepvarwcnvqstnvlqmmyekperwsf
tfqtyaclsriraqlaslngkekpvlffersvysdryifasnlyesecmnetewtiyqdw
hdwmnnqfgqsleldgiiylqatpetclhriylrgrneeqgipleyleklhykheswllh
rtlktnfdylqevpiltldvnedfkdkyeslvekvkeflstl

SCOPe Domain Coordinates for d2a2zc_:

Click to download the PDB-style file with coordinates for d2a2zc_.
(The format of our PDB-style files is described here.)

Timeline for d2a2zc_: