Lineage for d1bjqc_ (1bjq C:)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2042196Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2042197Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2042198Family b.29.1.1: Legume lectins [49900] (5 protein domains)
  6. 2042364Protein Legume lectin [49904] (23 species)
  7. 2042469Species Horse gram (Dolichos biflorus), different isoforms [TaxId:3840] [49915] (5 PDB entries)
  8. 2042481Domain d1bjqc_: 1bjq C: [24119]
    complexed with ade, ca, mn

Details for d1bjqc_

PDB Entry: 1bjq (more details), 2.65 Å

PDB Description: the dolichos biflorus seed lectin in complex with adenine
PDB Compounds: (C:) lectin

SCOPe Domain Sequences for d1bjqc_:

Sequence, based on SEQRES records: (download)

>d1bjqc_ b.29.1.1 (C:) Legume lectin {Horse gram (Dolichos biflorus), different isoforms [TaxId: 3840]}
aniqsfsfknfnspsfilqgdatvssgklqltkvkengiptpsslgrafysspiqiydks
tgavaswatsftvkisapskasfadgiafalvpvgseprrnggylgvfdsdvynnsaqtv
avefdtlsnsgwdpsmkhigidvnsiksiatvswdlangenaeilitynaatsllvaslv
hpsrrtsyilservditnelpeyvsvgfsattglsegyiethdvlswsfasklpd

Sequence, based on observed residues (ATOM records): (download)

>d1bjqc_ b.29.1.1 (C:) Legume lectin {Horse gram (Dolichos biflorus), different isoforms [TaxId: 3840]}
aniqsfsfknfnspsfilqgdatvssgklqltkvkengiptpsslgrafysspiqiydks
tgavaswatsftvkisapasfadgiafalvpvgseprrnggylgvfdsdvynnsaqtvav
efdtlsnsgwdpsmkhigidvnsiksiatvswdlangenaeilitynaatsllvaslvhp
srrtsyilservditnelpeyvsvgfsattglsegyiethdvlswsfasklpd

SCOPe Domain Coordinates for d1bjqc_:

Click to download the PDB-style file with coordinates for d1bjqc_.
(The format of our PDB-style files is described here.)

Timeline for d1bjqc_: