SCOP 1.67: Domain d1bjqb_: 1bjq B:

Lineage for d1bjqb_ (1bjq B:)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
   sandwich; 12-14 strands in 2 sheets; complex topology

4. Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (20 families)

5. Family b.29.1.1: Legume lectins [49900] (4 proteins)

6. Protein Legume lectin [49904] (23 species)

7. Species Horse gram (Dolichos biflorus), different isoforms [TaxId:3840] [49915] (5 PDB entries)

8. Domain d1bjqb_: 1bjq B: [24118]

Details for d1bjqb_

PDB Entry: 1bjq, 2.65 Å

PDB Description: the dolichos biflorus seed lectin in complex with adenine

SCOP Domain Sequences for d1bjqb_:

Sequence; same for both SEQRES and ATOM records:

>d1bjqb_ b.29.1.1 (B:) Legume lectin {Horse gram (Dolichos biflorus), different isoforms}
aniqsfsfknfnspsfilqgdatvssgklqltkvkengiptpsslgrafysspiqiydks
tgavaswatsftvkisapskasfadgiafalvpvgseprrnggylgvfdsdvynnsaqtv
avefdtlsnsgwdpsmkhigidvnsiksiatvswdlangenaeilitynaatsllvaslv
hpsrrtsyilservditnelpeyvsvgfsattglsegyiethdvlswsfasklpddstae
pldlasylvrnvl

Timeline for d1bjqb_:

• d1bjqb_ first appeared (with stable ids) in SCOP 1.55
  
• d1bjqb_ appears in SCOP 1.65
  
• d1bjqb_ appears in SCOP 1.69
  
• d1bjqb_ appears in the current release, SCOPe 2.08