Lineage for d1bjqb_ (1bjq B:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 12390Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
  4. 12391Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (11 families) (S)
  5. 12392Family b.29.1.1: Legume lectins [49900] (4 proteins)
  6. 12495Protein Lectin [49904] (15 species)
  7. 12549Species Horse gram (Dolichos biflorus), different isoforms [TaxId:3840] [49915] (5 PDB entries)
  8. 12558Domain d1bjqb_: 1bjq B: [24118]

Details for d1bjqb_

PDB Entry: 1bjq (more details), 2.65 Å

PDB Description: the dolichos biflorus seed lectin in complex with adenine

SCOP Domain Sequences for d1bjqb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bjqb_ b.29.1.1 (B:) Lectin {Horse gram (Dolichos biflorus), different isoforms}
aniqsfsfknfnspsfilqgdatvssgklqltkvkengiptpsslgrafysspiqiydks
tgavaswatsftvkisapskasfadgiafalvpvgseprrnggylgvfdsdvynnsaqtv
avefdtlsnsgwdpsmkhigidvnsiksiatvswdlangenaeilitynaatsllvaslv
hpsrrtsyilservditnelpeyvsvgfsattglsegyiethdvlswsfasklpddstae
pldlasylvrnvl

SCOP Domain Coordinates for d1bjqb_:

Click to download the PDB-style file with coordinates for d1bjqb_.
(The format of our PDB-style files is described here.)

Timeline for d1bjqb_: