Lineage for d1bjqb_ (1bjq B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2778274Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2778275Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (27 families) (S)
  5. 2778276Family b.29.1.1: Legume lectins [49900] (5 proteins)
  6. 2778483Protein Legume lectin [49904] (23 species)
  7. 2778592Species Horse gram (Dolichos biflorus), different isoforms [TaxId:3840] [49915] (5 PDB entries)
  8. 2778600Domain d1bjqb_: 1bjq B: [24118]
    complexed with ade, ca, mn

Details for d1bjqb_

PDB Entry: 1bjq (more details), 2.65 Å

PDB Description: the dolichos biflorus seed lectin in complex with adenine
PDB Compounds: (B:) lectin

SCOPe Domain Sequences for d1bjqb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bjqb_ b.29.1.1 (B:) Legume lectin {Horse gram (Dolichos biflorus), different isoforms [TaxId: 3840]}
aniqsfsfknfnspsfilqgdatvssgklqltkvkengiptpsslgrafysspiqiydks
tgavaswatsftvkisapskasfadgiafalvpvgseprrnggylgvfdsdvynnsaqtv
avefdtlsnsgwdpsmkhigidvnsiksiatvswdlangenaeilitynaatsllvaslv
hpsrrtsyilservditnelpeyvsvgfsattglsegyiethdvlswsfasklpddstae
pldlasylvrnvl

SCOPe Domain Coordinates for d1bjqb_:

Click to download the PDB-style file with coordinates for d1bjqb_.
(The format of our PDB-style files is described here.)

Timeline for d1bjqb_: