SCOPe 2.04: Domain d1zy1a_: 1zy1 A:

Lineage for d1zy1a_ (1zy1 A:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.167: Peptide deformylase [56419] (1 superfamily)
   alpha-beta(5)-alpha; 3 layers: a/b/a; meander beta-sheet wraps around the C-terminal alpha-helix

4. Superfamily d.167.1: Peptide deformylase [56420] (2 families)
   nickel-dependent enzyme

5. Family d.167.1.0: automated matches [191587] (1 protein)
   not a true family

6. Protein automated matches [191055] (11 species)
   not a true protein

7. Species Thale cress (Arabidopsis thaliana) [TaxId:3702] [230479] (5 PDB entries)

8. Domain d1zy1a_: 1zy1 A: [241178]
   automated match to d4je6a_
   complexed with zn

Details for d1zy1a_

PDB Entry: 1zy1, 3 Å

PDB Description: X-ray structure of peptide deformylase from Arabidopsis thaliana (AtPDF1A) in complex with Met-Ala-Ser

PDB Compounds: (A:) Peptide deformylase, mitochondrial

SCOPe Domain Sequences for d1zy1a_:

Sequence; same for both SEQRES and ATOM records:

>d1zy1a_ d.167.1.0 (A:) automated matches {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}
dlpeivasgdpvlhekarevdpgeigseriqkiiddmikvmrlapgvglaapqigvplri
ivledtkeyisyapkeeilaqerrhfdlmvmvnpvlkersnkkalffegclsvdgfraav
erylevvvtgydrqgkrievnasgwqarilqhecdhldgnlyvdkmvprtfrtvdnldlp
laegcpklgsh

Timeline for d1zy1a_:

• d1zy1a_ is new in SCOPe 2.04-stable
  
• d1zy1a_ appears in SCOPe 2.05
  
• d1zy1a_ appears in the current release, SCOPe 2.08, called d1zy1a1