Lineage for d1zxga_ (1zxg A:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2310325Fold a.8: immunoglobulin/albumin-binding domain-like [46996] (11 superfamilies)
    3 helices; bundle, closed, left-handed twist; up-and-down; mirror topology to the spectrin-like fold
  4. 2310326Superfamily a.8.1: Bacterial immunoglobulin/albumin-binding domains [46997] (3 families) (S)
  5. 2310327Family a.8.1.1: Immunoglobulin-binding protein A modules [46998] (2 proteins)
    automatically mapped to Pfam PF02216
  6. 2310424Protein automated matches [191290] (5 species)
    not a true protein
  7. 2310432Species Staphylococcus aureus [TaxId:1280] [189943] (19 PDB entries)
  8. 2310462Domain d1zxga_: 1zxg A: [241176]
    automated match to d1bdca_

Details for d1zxga_

PDB Entry: 1zxg (more details)

PDB Description: solution structure of a219
PDB Compounds: (A:) immunoglobulin g binding protein a

SCOPe Domain Sequences for d1zxga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zxga_ a.8.1.1 (A:) automated matches {Staphylococcus aureus [TaxId: 1280]}
myylvvnkqqnafyevlnmpnlnedqrnafiqslkddpsqsanvlaeaqklndvqapka

SCOPe Domain Coordinates for d1zxga_:

Click to download the PDB-style file with coordinates for d1zxga_.
(The format of our PDB-style files is described here.)

Timeline for d1zxga_: