![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.9: Peripheral subunit-binding domain of 2-oxo acid dehydrogenase complex [47004] (1 superfamily) 3 helices; bundle, closed, right-handed twist; up-and-down |
![]() | Superfamily a.9.1: Peripheral subunit-binding domain of 2-oxo acid dehydrogenase complex [47005] (2 families) ![]() |
![]() | Family a.9.1.0: automated matches [191674] (1 protein) not a true family |
![]() | Protein automated matches [191291] (5 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [189945] (2 PDB entries) |
![]() | Domain d1zwva1: 1zwv A:2-50 [241175] Other proteins in same PDB: d1zwva2, d1zwva3 automated match to d3rnme_ |
PDB Entry: 1zwv (more details)
SCOPe Domain Sequences for d1zwva1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zwva1 a.9.1.0 (A:2-50) automated matches {Human (Homo sapiens) [TaxId: 9606]} eikgrktlatpavrrlamenniklsevvgsgkdgrilkedilnylekqt
Timeline for d1zwva1: