Lineage for d1zwva1 (1zwv A:2-50)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2310709Fold a.9: Peripheral subunit-binding domain of 2-oxo acid dehydrogenase complex [47004] (1 superfamily)
    3 helices; bundle, closed, right-handed twist; up-and-down
  4. 2310710Superfamily a.9.1: Peripheral subunit-binding domain of 2-oxo acid dehydrogenase complex [47005] (2 families) (S)
  5. 2310740Family a.9.1.0: automated matches [191674] (1 protein)
    not a true family
  6. 2310741Protein automated matches [191291] (5 species)
    not a true protein
  7. 2310752Species Human (Homo sapiens) [TaxId:9606] [189945] (2 PDB entries)
  8. 2310755Domain d1zwva1: 1zwv A:2-50 [241175]
    Other proteins in same PDB: d1zwva2, d1zwva3
    automated match to d3rnme_

Details for d1zwva1

PDB Entry: 1zwv (more details)

PDB Description: solution structure of the subunit binding domain (hbsbd) of the human mitochondrial branched-chain alpha-ketoacid dehydrogenase
PDB Compounds: (A:) Lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex, mitochondrial

SCOPe Domain Sequences for d1zwva1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zwva1 a.9.1.0 (A:2-50) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eikgrktlatpavrrlamenniklsevvgsgkdgrilkedilnylekqt

SCOPe Domain Coordinates for d1zwva1:

Click to download the PDB-style file with coordinates for d1zwva1.
(The format of our PDB-style files is described here.)

Timeline for d1zwva1: