SCOPe 2.08: Domain d1zwva1: 1zwv A:2-50

Lineage for d1zwva1 (1zwv A:2-50)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.9: Peripheral subunit-binding domain of 2-oxo acid dehydrogenase complex [47004] (1 superfamily)
   3 helices; bundle, closed, right-handed twist; up-and-down

4. Superfamily a.9.1: Peripheral subunit-binding domain of 2-oxo acid dehydrogenase complex [47005] (2 families)

5. Family a.9.1.0: automated matches [191674] (1 protein)
   not a true family

6. Protein automated matches [191291] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189945] (2 PDB entries)

8. Domain d1zwva1: 1zwv A:2-50 [241175]
   Other proteins in same PDB: d1zwva2, d1zwva3
   automated match to d3rnme_

Details for d1zwva1

PDB Entry: 1zwv

PDB Description: solution structure of the subunit binding domain (hbsbd) of the human mitochondrial branched-chain alpha-ketoacid dehydrogenase

PDB Compounds: (A:) Lipoamide acyltransferase component of branched-chain alpha-keto acid dehydrogenase complex, mitochondrial

SCOPe Domain Sequences for d1zwva1:

Sequence; same for both SEQRES and ATOM records:

>d1zwva1 a.9.1.0 (A:2-50) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eikgrktlatpavrrlamenniklsevvgsgkdgrilkedilnylekqt

Timeline for d1zwva1:

• d1zwva1 first appeared in SCOPe 2.04, called d1zwva_
  
• d1zwva1 appears in SCOPe 2.07