Class b: All beta proteins [48724] (176 folds) |
Fold b.11: gamma-Crystallin-like [49694] (1 superfamily) sandwich; 8 strands in 2 sheets; greek-key duplication: has internal pseudo twofold symmetry |
Superfamily b.11.1: gamma-Crystallin-like [49695] (7 families) |
Family b.11.1.1: Crystallins/Ca-binding development proteins [49696] (5 proteins) |
Protein gamma-Crystallin [49697] (8 species) duplication consists of two domains of this fold |
Species Mouse (Mus musculus) [TaxId:10090] [255018] (3 PDB entries) |
Domain d1zwoa2: 1zwo A:91-177 [241174] automated match to d1amma2 |
PDB Entry: 1zwo (more details)
SCOPe Domain Sequences for d1zwoa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zwoa2 b.11.1.1 (A:91-177) gamma-Crystallin {Mouse (Mus musculus) [TaxId: 10090]} gqakiqvfekgdfngqmyettedcpsimeqfhlreihsckvvegtwifyelpnyrgrqyl ldkkeyrkpvdwgaaspaiqsfrrive
Timeline for d1zwoa2: