Lineage for d1zwma2 (1zwm A:91-177)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2773464Fold b.11: gamma-Crystallin-like [49694] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key
    duplication: has internal pseudo twofold symmetry
  4. 2773465Superfamily b.11.1: gamma-Crystallin-like [49695] (7 families) (S)
  5. 2773466Family b.11.1.1: Crystallins/Ca-binding development proteins [49696] (5 proteins)
  6. 2773504Protein gamma-Crystallin [49697] (9 species)
    duplication consists of two domains of this fold
  7. 2773544Species Mouse (Mus musculus) [TaxId:10090] [255018] (5 PDB entries)
  8. 2773562Domain d1zwma2: 1zwm A:91-177 [241172]
    automated match to d1amma2

Details for d1zwma2

PDB Entry: 1zwm (more details)

PDB Description: nmr structure of murine gamma-s crystallin
PDB Compounds: (A:) gamma crystallin s

SCOPe Domain Sequences for d1zwma2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zwma2 b.11.1.1 (A:91-177) gamma-Crystallin {Mouse (Mus musculus) [TaxId: 10090]}
gqakiqvfekgdfngqmyettedcpsimeqfhlreihsckvvegtwifyelpnyrgrqyl
ldkkeyrkpvdwgaaspaiqsfrrive

SCOPe Domain Coordinates for d1zwma2:

Click to download the PDB-style file with coordinates for d1zwma2.
(The format of our PDB-style files is described here.)

Timeline for d1zwma2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1zwma1