![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.14: VHP, Villin headpiece domain [47049] (1 superfamily) 3 short helices; irregular array |
![]() | Superfamily a.14.1: VHP, Villin headpiece domain [47050] (2 families) ![]() |
![]() | Family a.14.1.1: VHP, Villin headpiece domain [47051] (5 proteins) |
![]() | Protein automated matches [254472] (1 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [255017] (1 PDB entry) |
![]() | Domain d1zv6a_: 1zv6 A: [241169] automated match to d1qzpa_ mutant |
PDB Entry: 1zv6 (more details)
SCOPe Domain Sequences for d1zv6a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zv6a_ a.14.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} pglqiypyemlvvtnkgrtklppgvdrmrlerhlsaedfsrvfamspeefgklalwkrne lkkkaelf
Timeline for d1zv6a_: