Lineage for d1zv6a_ (1zv6 A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2697673Fold a.14: VHP, Villin headpiece domain [47049] (1 superfamily)
    3 short helices; irregular array
  4. 2697674Superfamily a.14.1: VHP, Villin headpiece domain [47050] (2 families) (S)
  5. 2697675Family a.14.1.1: VHP, Villin headpiece domain [47051] (5 proteins)
  6. 2697705Protein automated matches [254472] (1 species)
    not a true protein
  7. 2697706Species Human (Homo sapiens) [TaxId:9606] [255017] (1 PDB entry)
  8. 2697707Domain d1zv6a_: 1zv6 A: [241169]
    automated match to d1qzpa_
    mutant

Details for d1zv6a_

PDB Entry: 1zv6 (more details)

PDB Description: nmr structure of the human dematin headpiece s74e mutant
PDB Compounds: (A:) EPB49 protein

SCOPe Domain Sequences for d1zv6a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zv6a_ a.14.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pglqiypyemlvvtnkgrtklppgvdrmrlerhlsaedfsrvfamspeefgklalwkrne
lkkkaelf

SCOPe Domain Coordinates for d1zv6a_:

Click to download the PDB-style file with coordinates for d1zv6a_.
(The format of our PDB-style files is described here.)

Timeline for d1zv6a_: