SCOPe 2.05: Domain d1ztvb_: 1ztv B:

Lineage for d1ztvb_ (1ztv B:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.32: TM1631-like [117396] (1 family)
   automatically mapped to Pfam PF01904

5. Family c.1.32.1: TM1631-like [117397] (3 proteins)
   Pfam PF01904; DUF72

6. Protein automated matches [254471] (1 species)
   not a true protein

7. Species Enterococcus faecalis [TaxId:226185] [255016] (1 PDB entry)

8. Domain d1ztvb_: 1ztv B: [241166]
   automated match to d1vpya_
   complexed with cl

Details for d1ztvb_

PDB Entry: 1ztv, 3.1 Å

PDB Description: Crystal structure of a duf72 family protein (ef0366) from enterococcus faecalis v583 at 3.10 A resolution

PDB Compounds: (B:) hypothetical protein

SCOPe Domain Sequences for d1ztvb_:

Sequence; same for both SEQRES and ATOM records:

>d1ztvb_ c.1.32.1 (B:) automated matches {Enterococcus faecalis [TaxId: 226185]}
mirlgltsfsehdyltgkkrstlyeyashlplvemdtayygippkervaewvkavpenfr
fvmkvysgiscqgewqtyyaseeemitaflesmaplieskklfaflvqfsgtfgctkenv
aylqkirhwfkdlpiaielrnnswyqpnfvkqmlqfmkenqfslvivdepqiptnpvpfy
pyvtnpnlvlfrfhgrnaagwlandaewrkkrtlyhyntqeiadlseavlkmsqeakevg
vifnnnsggdaaenalqmqkvlnlsyddlnpkqld

Timeline for d1ztvb_:

• d1ztvb_ first appeared in SCOPe 2.04
  
• d1ztvb_ appears in SCOPe 2.06
  
• d1ztvb_ appears in the current release, SCOPe 2.08