SCOPe 2.08: Domain d1ztsa1: 1zts A:1-131

Lineage for d1ztsa1 (1zts A:1-131)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.229: Hypothetical protein YqbG [116914] (1 superfamily)
   core: 4 helices; bundle, right-handed twist; left-handed superhelix

4. Superfamily a.229.1: Hypothetical protein YqbG [116915] (1 family)
   automatically mapped to Pfam PF11436

5. Family a.229.1.1: Hypothetical protein YqbG [116916] (1 protein)

6. Protein Hypothetical protein YqbG [116917] (1 species)

7. Species Bacillus subtilis [TaxId:1423] [116918] (2 PDB entries)
   Uniprot P45923

8. Domain d1ztsa1: 1zts A:1-131 [241164]
   Other proteins in same PDB: d1ztsa2
   automated match to d1xn8a_

Details for d1ztsa1

PDB Entry: 1zts

PDB Description: solution structure of bacillus subtilis protein yqbg: northeast structural genomics consortium target sr215

PDB Compounds: (A:) Hypothetical protein yqbG

SCOPe Domain Sequences for d1ztsa1:

Sequence; same for both SEQRES and ATOM records:

>d1ztsa1 a.229.1.1 (A:1-131) Hypothetical protein YqbG {Bacillus subtilis [TaxId: 1423]}
mllitpdelksysvfesvktrpdellkqdileatadiilkvghdfsdaeyiplpetvrla
llklsqfyalingdesiikgyttekigdysytlgdgsslqkpdvyalikdyvkpadpdle
gieakvrmrsi

Timeline for d1ztsa1:

• d1ztsa1 first appeared in SCOPe 2.04, called d1ztsa_
  
• d1ztsa1 appears in SCOPe 2.07