Lineage for d1ztgb1 (1ztg B:14-85)

  1. Root: SCOPe 2.06
  2. 2170735Class d: Alpha and beta proteins (a+b) [53931] (385 folds)
  3. 2190768Fold d.51: Eukaryotic type KH-domain (KH-domain type I) [54790] (1 superfamily)
    beta-alpha(2)-beta(2)-alpha; 2 layers: alpha/beta
  4. 2190769Superfamily d.51.1: Eukaryotic type KH-domain (KH-domain type I) [54791] (2 families) (S)
    Prokaryotic and eukaryotic domains share a KH-motif but have different topologies
  5. 2190770Family d.51.1.1: Eukaryotic type KH-domain (KH-domain type I) [54792] (17 proteins)
    an RNA-binding domain
  6. 2190861Protein automated matches [195910] (2 species)
    not a true protein
  7. 2190862Species Human (Homo sapiens) [TaxId:9606] [195911] (4 PDB entries)
  8. 2190871Domain d1ztgb1: 1ztg B:14-85 [241161]
    Other proteins in same PDB: d1ztga2, d1ztgb2, d1ztgc2, d1ztgd2
    automated match to d3vkea_
    protein/DNA complex; protein/RNA complex

Details for d1ztgb1

PDB Entry: 1ztg (more details), 3 Å

PDB Description: human alpha polyC binding protein KH1
PDB Compounds: (B:) Poly(rC)-binding protein 1

SCOPe Domain Sequences for d1ztgb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ztgb1 d.51.1.1 (B:14-85) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ltirllmhgkevgsiigkkgesvkrireesgarinisegncperiitltgptnaifkafa
miidkleedins

SCOPe Domain Coordinates for d1ztgb1:

Click to download the PDB-style file with coordinates for d1ztgb1.
(The format of our PDB-style files is described here.)

Timeline for d1ztgb1: