Lineage for d1lu1a_ (1lu1 A:)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1307103Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 1307104Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 1307105Family b.29.1.1: Legume lectins [49900] (5 proteins)
  6. 1307253Protein Legume lectin [49904] (23 species)
  7. 1307358Species Horse gram (Dolichos biflorus), different isoforms [TaxId:3840] [49915] (5 PDB entries)
  8. 1307365Domain d1lu1a_: 1lu1 A: [24116]
    complexed with ade, ca, mn

Details for d1lu1a_

PDB Entry: 1lu1 (more details), 2.6 Å

PDB Description: the structure of the dolichos biflorus seed lectin in complex with the forssman disaccharide
PDB Compounds: (A:) lectin

SCOPe Domain Sequences for d1lu1a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lu1a_ b.29.1.1 (A:) Legume lectin {Horse gram (Dolichos biflorus), different isoforms [TaxId: 3840]}
aniqsfsfknfnspsfilqgdatvssgklqltkvkengiptpsslgrafysspiqiydks
tgavaswatsftvkisapskasfadgiafalvpvgseprrnggylgvfdsdvynnsaqtv
avefdtlsnsgwdpsmkhigidvnsiksiatvswdlangenaeilitynaatsllvaslv
hpsrrtsyilservditnelpeyvsvgfsattglsegyiethdvlswsfasklpddstae
pldlasylvrnvl

SCOPe Domain Coordinates for d1lu1a_:

Click to download the PDB-style file with coordinates for d1lu1a_.
(The format of our PDB-style files is described here.)

Timeline for d1lu1a_: