Lineage for d1lu1__ (1lu1 -)
- Root: SCOP 1.61
Class b: All beta proteins [48724] (111 folds) 
Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily) Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (14 families) 
Family b.29.1.1: Legume lectins [49900] (4 proteins) 
Protein Legume lectin [49904] (20 species) 
Species Horse gram (Dolichos biflorus), different isoforms [TaxId:3840] [49915] (5 PDB entries) 
Domain d1lu1__: 1lu1 - [24116]
Details for d1lu1__
PDB Entry: 1lu1 (more details), 2.6 Å
PDB Description: the structure of the dolichos biflorus seed lectin in complex with the forssman disaccharide
SCOP Domain Sequences for d1lu1__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1lu1__ b.29.1.1 (-) Legume lectin {Horse gram (Dolichos biflorus), different isoforms}
aniqsfsfknfnspsfilqgdatvssgklqltkvkengiptpsslgrafysspiqiydks
tgavaswatsftvkisapskasfadgiafalvpvgseprrnggylgvfdsdvynnsaqtv
avefdtlsnsgwdpsmkhigidvnsiksiatvswdlangenaeilitynaatsllvaslv
hpsrrtsyilservditnelpeyvsvgfsattglsegyiethdvlswsfasklpddstae
pldlasylvrnvl
SCOP Domain Coordinates for d1lu1__:
Click to download the PDB-style file with coordinates for d1lu1__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1lu1__:
- d1lu1__ first appeared (with stable ids) in SCOP 1.55
- d1lu1__ appears in SCOP 1.59
- d1lu1__ appears in SCOP 1.63
- d1lu1__ appears in the current release, SCOPe 2.08, called d1lu1a_
View in 3D