SCOPe 2.05: Domain d1zp7a_: 1zp7 A:

Lineage for d1zp7a_ (1zp7 A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.52: Restriction endonuclease-like [52979] (4 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 5 strands, order 12345; strands 2 &, in some families, 5 are antiparallel to the rest

4. Superfamily c.52.1: Restriction endonuclease-like [52980] (35 families)

5. Family c.52.1.28: RecU-like [117631] (2 proteins)
   Pfam PF03838

6. Protein automated matches [254470] (2 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:1423] [255014] (1 PDB entry)

8. Domain d1zp7a_: 1zp7 A: [241157]
   automated match to d1y1oa_

Details for d1zp7a_

PDB Entry: 1zp7, 2.25 Å

PDB Description: The structure of Bacillus subtilis RecU Holliday junction resolvase and its role in substrate selection and sequence specific cleavage.

PDB Compounds: (A:) Recombination protein U

SCOPe Domain Sequences for d1zp7a_:

Sequence, based on SEQRES records:

>d1zp7a_ c.52.1.28 (A:) automated matches {Bacillus subtilis [TaxId: 1423]}
tleddlnetnkyyltnqiavihkkptpvqivnvhypkrsaavikeayfkqssttdyngiy
kgryidfeaketknktsfplqnfhdhqiehmkqvkaqdgicfviisafdqvyfleadklf
yfwdrkekngrksirkdeleetaypislgyapridyisiieqlyfs

Sequence, based on observed residues (ATOM records):

>d1zp7a_ c.52.1.28 (A:) automated matches {Bacillus subtilis [TaxId: 1423]}
tleddlnetnkyyltnqiavihkkptpvqivnayfkqssttdyngiykgryidfeaketk
nktsfplqnfhdhqiehmkqvkaqdgicfviisafdqvyfleadklfyfwdrkekngrks
irkdeleetaypislgyapridyisiieqlyfs

Timeline for d1zp7a_:

• d1zp7a_ first appeared in SCOPe 2.04
  
• d1zp7a_ appears in SCOPe 2.06
  
• d1zp7a_ appears in the current release, SCOPe 2.08