Lineage for d1zmxg_ (1zmx G:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2109205Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 protein domains)
    parallel beta-sheet of 5 strands, order 23145
  6. 2109738Protein automated matches [190087] (10 species)
    not a true protein
  7. 2109748Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [233748] (5 PDB entries)
  8. 2109770Domain d1zmxg_: 1zmx G: [241155]
    automated match to d2vp4d_
    complexed with so4, thm; mutant

Details for d1zmxg_

PDB Entry: 1zmx (more details), 3.1 Å

PDB Description: Crystal structure of D. melanogaster deoxyribonucleoside kinase N64D mutant in complex with thymidine
PDB Compounds: (G:) deoxynucleoside kinase

SCOPe Domain Sequences for d1zmxg_:

Sequence, based on SEQRES records: (download)

>d1zmxg_ c.37.1.1 (G:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
tkyaegtqpftvliegnigsgkttylnhfekykndiclltepvekwrnvngvdllelmyk
dpkkwampfqsyvtltmlqshtaptnkklkimersifsarycfvenmrrngsleqgmynt
leewykfieesihvqadliiylrtspevayerirqrarseescvplkylqelhelhedwl
ihqrrpqsckvlvlda

Sequence, based on observed residues (ATOM records): (download)

>d1zmxg_ c.37.1.1 (G:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
tkyaegtqpftvliegnigsgkttylnhfekykndiclltepvekwrnvngvdllelmyk
dpkkwampfqsyvtltmlqshtaptnkklkimersifsarycfvenmrrngsleqgmynt
leewykfieesihvqadliiylrtspevayerirqrvplkylqelhelhedwlihqrrpq
sckvlvlda

SCOPe Domain Coordinates for d1zmxg_:

Click to download the PDB-style file with coordinates for d1zmxg_.
(The format of our PDB-style files is described here.)

Timeline for d1zmxg_: