Lineage for d1zmxf_ (1zmx F:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2109203Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 2109204Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (26 families) (S)
    division into families based on beta-sheet topologies
  5. 2109205Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 protein domains)
    parallel beta-sheet of 5 strands, order 23145
  6. 2109738Protein automated matches [190087] (10 species)
    not a true protein
  7. 2109748Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [233748] (5 PDB entries)
  8. 2109769Domain d1zmxf_: 1zmx F: [241154]
    automated match to d2vp4d_
    complexed with so4, thm; mutant

Details for d1zmxf_

PDB Entry: 1zmx (more details), 3.1 Å

PDB Description: Crystal structure of D. melanogaster deoxyribonucleoside kinase N64D mutant in complex with thymidine
PDB Compounds: (F:) deoxynucleoside kinase

SCOPe Domain Sequences for d1zmxf_:

Sequence, based on SEQRES records: (download)

>d1zmxf_ c.37.1.1 (F:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
tkyaegtqpftvliegnigsgkttylnhfekykndiclltepvekwrnvngvdllelmyk
dpkkwampfqsyvtltmlqshtaptnkklkimersifsarycfvenmrrngsleqgmynt
leewykfieesihvqadliiylrtspevayerirqrarseescvplkylqelhelhedwl
ihqrrpqsckvlvldad

Sequence, based on observed residues (ATOM records): (download)

>d1zmxf_ c.37.1.1 (F:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
tkyaegtqpftvliegnigsgkttylnhfekykndiclltepvekwrnvngvdllelmyk
dpkkwampfqsyvtltmlqshtaptnkklkimersifsarycfvenmrrngsleqgmynt
leewykfieesihvqadliiylrtspevayerirqrscvplkylqelhelhedwlihqck
vlvldad

SCOPe Domain Coordinates for d1zmxf_:

Click to download the PDB-style file with coordinates for d1zmxf_.
(The format of our PDB-style files is described here.)

Timeline for d1zmxf_: