Lineage for d1zm7b_ (1zm7 B:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1593542Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
    3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes
  4. 1593543Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (25 families) (S)
    division into families based on beta-sheet topologies
  5. 1593544Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins)
    parallel beta-sheet of 5 strands, order 23145
  6. 1594046Protein automated matches [190087] (8 species)
    not a true protein
  7. 1594053Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [233748] (5 PDB entries)
  8. 1594056Domain d1zm7b_: 1zm7 B: [241146]
    automated match to d2vp4d_
    complexed with mg, ttp; mutant

Details for d1zm7b_

PDB Entry: 1zm7 (more details), 2.2 Å

PDB Description: crystal structure of d. melanogaster deoxyribonucleoside kinase mutant n64d in complex with dttp
PDB Compounds: (B:) deoxynucleoside kinase

SCOPe Domain Sequences for d1zm7b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zm7b_ c.37.1.1 (B:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]}
tkyaegtqpftvliegnigsgkttylnhfekykndiclltepvekwrnvngvdllelmyk
dpkkwampfqsyvtltmlqshtaptnkklkimersifsarycfvenmrrngsleqgmynt
leewykfieesihvqadliiylrtspevayerirqrarseescvplkylqelhelhedwl
ihqrrpqsckvlvldadl

SCOPe Domain Coordinates for d1zm7b_:

Click to download the PDB-style file with coordinates for d1zm7b_.
(The format of our PDB-style files is described here.)

Timeline for d1zm7b_: