![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily) 3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes |
![]() | Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families) ![]() division into families based on beta-sheet topologies |
![]() | Family c.37.1.1: Nucleotide and nucleoside kinases [52541] (21 proteins) parallel beta-sheet of 5 strands, order 23145 |
![]() | Protein automated matches [190087] (15 species) not a true protein |
![]() | Species Fruit fly (Drosophila melanogaster) [TaxId:7227] [233748] (6 PDB entries) |
![]() | Domain d1zm7a_: 1zm7 A: [241145] automated match to d2vp4d_ complexed with mg, ttp; mutant |
PDB Entry: 1zm7 (more details), 2.2 Å
SCOPe Domain Sequences for d1zm7a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zm7a_ c.37.1.1 (A:) automated matches {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} tkyaegtqpftvliegnigsgkttylnhfekykndiclltepvekwrnvngvdllelmyk dpkkwampfqsyvtltmlqshtaptnkklkimersifsarycfvenmrrngsleqgmynt leewykfieesihvqadliiylrtspevayerirqrarseescvplkylqelhelhedwl ihqrrpqsckvlvldad
Timeline for d1zm7a_: