SCOPe 2.08: Domain d1zlkb_: 1zlk B:

Lineage for d1zlkb_ (1zlk B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.6: C-terminal effector domain of the bipartite response regulators [46894] (4 families)
   binds to DNA and RNA polymerase; the N-terminal, receiver domain belongs to the CheY family

5. Family a.4.6.0: automated matches [191513] (1 protein)
   not a true family

6. Protein automated matches [190858] (25 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:1773] [188191] (3 PDB entries)

8. Domain d1zlkb_: 1zlk B: [241142]
   automated match to d1zljb_
   protein/DNA complex

Details for d1zlkb_

PDB Entry: 1zlk, 3.1 Å

PDB Description: Crystal Structure of the Mycobacterium tuberculosis Hypoxic Response Regulator DosR C-terminal Domain-DNA Complex

PDB Compounds: (B:) Dormancy Survival Regulator

SCOPe Domain Sequences for d1zlkb_:

Sequence; same for both SEQRES and ATOM records:

>d1zlkb_ a.4.6.0 (B:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
dplsgltdqertllgllsegltnkqiadrmflaektvknyvsrllaklgmerrtqaavfa
telkr

Timeline for d1zlkb_:

• d1zlkb_ first appeared in SCOPe 2.04
  
• d1zlkb_ appears in SCOPe 2.07