SCOPe 2.07: Domain d1zlka_: 1zlk A:

Lineage for d1zlka_ (1zlk A:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.6: C-terminal effector domain of the bipartite response regulators [46894] (4 families)
   binds to DNA and RNA polymerase; the N-terminal, receiver domain belongs to the CheY family

5. Family a.4.6.0: automated matches [191513] (1 protein)
   not a true family

6. Protein automated matches [190858] (24 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:1773] [188191] (3 PDB entries)

8. Domain d1zlka_: 1zlk A: [241141]
   automated match to d1zljb_
   protein/DNA complex

Details for d1zlka_

PDB Entry: 1zlk, 3.1 Å

PDB Description: Crystal Structure of the Mycobacterium tuberculosis Hypoxic Response Regulator DosR C-terminal Domain-DNA Complex

PDB Compounds: (A:) Dormancy Survival Regulator

SCOPe Domain Sequences for d1zlka_:

Sequence; same for both SEQRES and ATOM records:

>d1zlka_ a.4.6.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
dplsgltdqertllgllsegltnkqiadrmflaektvknyvsrllaklgmerrtqaavfa
telkr

Timeline for d1zlka_:

• d1zlka_ first appeared in SCOPe 2.04
  
• d1zlka_ appears in SCOPe 2.06
  
• d1zlka_ appears in the current release, SCOPe 2.08