SCOPe 2.06: Domain d1zk6a_: 1zk6 A:

Lineage for d1zk6a_ (1zk6 A:)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.26: FKBP-like [54533] (3 superfamilies)
   core: beta(2)-alpha-beta(2); antiparallel beta-sheet

4. Superfamily d.26.1: FKBP-like [54534] (4 families)

5. Family d.26.1.0: automated matches [191631] (1 protein)
   not a true family

6. Protein automated matches [191162] (27 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:1423] [255009] (1 PDB entry)

8. Domain d1zk6a_: 1zk6 A: [241140]
   automated match to d3ui4a_

Details for d1zk6a_

PDB Entry: 1zk6

PDB Description: nmr solution structure of b. subtilis prsa ppiase

PDB Compounds: (A:) Foldase protein prsA

SCOPe Domain Sequences for d1zk6a_:

Sequence; same for both SEQRES and ATOM records:

>d1zk6a_ d.26.1.0 (A:) automated matches {Bacillus subtilis [TaxId: 1423]}
gkirashilvadkktaeevekklkkgekfedlakeystdssaskggdlgwfakegqmdet
fskaafklktgevsdpvktqygyhiikktee

Timeline for d1zk6a_:

• d1zk6a_ first appeared in SCOPe 2.04
  
• d1zk6a_ appears in SCOPe 2.05
  
• d1zk6a_ appears in SCOPe 2.07
  
• d1zk6a_ appears in the current release, SCOPe 2.08