Lineage for d1g7ye_ (1g7y E:)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 108496Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
  4. 108497Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (12 families) (S)
  5. 108498Family b.29.1.1: Legume lectins [49900] (4 proteins)
  6. 108607Protein Legume lectin [49904] (19 species)
  7. 108672Species Horse gram (Dolichos biflorus), different isoforms [TaxId:3840] [49915] (5 PDB entries)
  8. 108677Domain d1g7ye_: 1g7y E: [24114]

Details for d1g7ye_

PDB Entry: 1g7y (more details), 2.5 Å

PDB Description: the crystal structure of the 58kd vegetative lectin from the tropical legume dolichos biflorus

SCOP Domain Sequences for d1g7ye_:

Sequence, based on SEQRES records: (download)

>d1g7ye_ b.29.1.1 (E:) Legume lectin {Horse gram (Dolichos biflorus), different isoforms}
adiqsfsfknfnsssfilqgdatvsssklrltkvkgnglptlsslgrafysspiqiydks
tgavaswatsftanifapnksssadgiafalvpvgsepksnsgflgvfdsdvydnsaqtv
avefdtfsntdwdptsrhigidvnsiksirtaswglangqnaeilitynaatsllvaslv
hpsrrtsyivservditnelpeyvsigfsattglsegytethdvlswsfasklpddstte
pldiasylvrnvl

Sequence, based on observed residues (ATOM records): (download)

>d1g7ye_ b.29.1.1 (E:) Legume lectin {Horse gram (Dolichos biflorus), different isoforms}
adiqsfsfknfnsssfilqgdatvsssklrltkvkgnglptlsslgrafysspiqiydks
tgavaswatsftanifapnksssadgiafalvpvgsepksnsgflgvfdsdvydnsaqtv
avefdtfsntdwdptsrhigidvnsiksirtaswglangqnaeilitynaatsllvaslv
hpsrrtsyivservditnelpeyvsigfsattglsegytethdvlswsfasklpddsldi
asylvrnvl

SCOP Domain Coordinates for d1g7ye_:

Click to download the PDB-style file with coordinates for d1g7ye_.
(The format of our PDB-style files is described here.)

Timeline for d1g7ye_: