Lineage for d1zcfh_ (1zcf H:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2142620Fold c.88: Glutaminase/Asparaginase [53773] (1 superfamily)
    consists of two non-similar alpha/beta domains, 3 layers (a/b/a) each
    Domain 1 has mixed beta-sheet of 6 strands, order 213456, strand 6 is antiparallel to the rest; left-handed crossover connection between strands 4 and 5
    Domain 2 has parallel beta-sheet of 4 strands, order 1234
  4. 2142621Superfamily c.88.1: Glutaminase/Asparaginase [53774] (2 families) (S)
  5. 2142622Family c.88.1.1: Glutaminase/Asparaginase [53775] (4 protein domains)
    automatically mapped to Pfam PF00710
  6. 2142708Protein automated matches [190446] (8 species)
    not a true protein
  7. 2142724Species Pectobacterium atrosepticum [TaxId:218491] [255007] (1 PDB entry)
  8. 2142732Domain d1zcfh_: 1zcf H: [241137]
    automated match to d1hg0a_

Details for d1zcfh_

PDB Entry: 1zcf (more details), 3 Å

PDB Description: l-asparaginase from erwinia carotovora
PDB Compounds: (H:) L-asparaginase

SCOPe Domain Sequences for d1zcfh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zcfh_ c.88.1.1 (H:) automated matches {Pectobacterium atrosepticum [TaxId: 218491]}
nlpnivilatggtiagsaaantqttgykagalgvetliqavpelktlanikgeqvasigs
enmtsdvlltlskrvnellarsdvdgvvithgtdtldespyflnltvksdkpvvfvaamr
pataisadgpmnlygavkvaadknsrgrgvlvvlndrigsarfisktnastldtfkapee
gylgviigdkiyyqtrldkvhttrsvfdvtnvdklpavdiiygyqddpeymydasikhgv
kgivyagmgagsvskrgdagirkaeskgivvvrssrtgsgivppdagqpglvadslspak
srillmlaltkttnpaviqdyfhay

SCOPe Domain Coordinates for d1zcfh_:

Click to download the PDB-style file with coordinates for d1zcfh_.
(The format of our PDB-style files is described here.)

Timeline for d1zcfh_: