Lineage for d1zaua_ (1zau A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2978525Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 2979301Superfamily d.142.2: DNA ligase/mRNA capping enzyme, catalytic domain [56091] (6 families) (S)
    has a circularly permuted topology
  5. 2979381Family d.142.2.0: automated matches [227263] (1 protein)
    not a true family
  6. 2979382Protein automated matches [227054] (5 species)
    not a true protein
  7. 2979394Species Mycobacterium tuberculosis [TaxId:1773] [255006] (1 PDB entry)
  8. 2979395Domain d1zaua_: 1zau A: [241127]
    automated match to d1b04b_
    complexed with amp

Details for d1zaua_

PDB Entry: 1zau (more details), 3.15 Å

PDB Description: adenylation domain of nad+ dependent dna ligase from m.tuberculosis
PDB Compounds: (A:) DNA ligase

SCOPe Domain Sequences for d1zaua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zaua_ d.142.2.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
qtapevlrqwqalaeevrehqfryyvrdapiisdaefdellrrlealeeqhpelrtpdsp
tqlvggagfatdfepvdhlermlsldnaftadelaawagrihaevgdaahylcelkidgv
alslvyregrltrastrgdgrtgedvtlnartiadvperltpgddypvpevlevrgevff
rlddfqalnaslveegkapfanprnsaagslrqkdpavtarrrlrmichglghvegfrpa
tlhqaylalrawglpvsehttlatdlagvreridywgehrhevdheidgvvvkvdevalq
rrlgstsraprwaiaykyppe

SCOPe Domain Coordinates for d1zaua_:

Click to download the PDB-style file with coordinates for d1zaua_.
(The format of our PDB-style files is described here.)

Timeline for d1zaua_: