![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.142: ATP-grasp [56058] (2 superfamilies) Consists of two subdomains with different alpha+beta folds shares functional and structural similarities with the PIPK and protein kinase superfamilies |
![]() | Superfamily d.142.2: DNA ligase/mRNA capping enzyme, catalytic domain [56091] (6 families) ![]() has a circularly permuted topology |
![]() | Family d.142.2.0: automated matches [227263] (1 protein) not a true family |
![]() | Protein automated matches [227054] (5 species) not a true protein |
![]() | Species Mycobacterium tuberculosis [TaxId:1773] [255006] (1 PDB entry) |
![]() | Domain d1zaua_: 1zau A: [241127] automated match to d1b04b_ complexed with amp |
PDB Entry: 1zau (more details), 3.15 Å
SCOPe Domain Sequences for d1zaua_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zaua_ d.142.2.0 (A:) automated matches {Mycobacterium tuberculosis [TaxId: 1773]} qtapevlrqwqalaeevrehqfryyvrdapiisdaefdellrrlealeeqhpelrtpdsp tqlvggagfatdfepvdhlermlsldnaftadelaawagrihaevgdaahylcelkidgv alslvyregrltrastrgdgrtgedvtlnartiadvperltpgddypvpevlevrgevff rlddfqalnaslveegkapfanprnsaagslrqkdpavtarrrlrmichglghvegfrpa tlhqaylalrawglpvsehttlatdlagvreridywgehrhevdheidgvvvkvdevalq rrlgstsraprwaiaykyppe
Timeline for d1zaua_: