Lineage for d1zada_ (1zad A:)

  1. Root: SCOPe 2.04
  2. 1700111Class g: Small proteins [56992] (91 folds)
  3. 1702133Fold g.7: Snake toxin-like [57301] (1 superfamily)
    disulfide-rich fold: nearly all-beta
  4. 1702134Superfamily g.7.1: Snake toxin-like [57302] (4 families) (S)
  5. 1702135Family g.7.1.1: Snake venom toxins [57303] (28 proteins)
    automatically mapped to Pfam PF00087
  6. 1702333Protein automated matches [190676] (7 species)
    not a true protein
  7. 1702350Species Naja oxiana [TaxId:8657] [254885] (2 PDB entries)
  8. 1702352Domain d1zada_: 1zad A: [241126]
    automated match to d2cdxa_

Details for d1zada_

PDB Entry: 1zad (more details)

PDB Description: structure of cytotoxin i (cti) from naja oxiana in complex with dpc micelle
PDB Compounds: (A:) Cytotoxin 1

SCOPe Domain Sequences for d1zada_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zada_ g.7.1.1 (A:) automated matches {Naja oxiana [TaxId: 8657]}
lkcnklvpiayktcpegknlcykmfmmsdltipvkrgcidvcpknsllvkyvccntdrcn

SCOPe Domain Coordinates for d1zada_:

Click to download the PDB-style file with coordinates for d1zada_.
(The format of our PDB-style files is described here.)

Timeline for d1zada_: