| Class b: All beta proteins [48724] (180 folds) |
| Fold b.34: SH3-like barrel [50036] (21 superfamilies) barrel, partly opened; n*=4, S*=8; meander the last strand is interrupted by a turn of 3-10 helix |
Superfamily b.34.2: SH3-domain [50044] (2 families) ![]() |
| Family b.34.2.0: automated matches [191375] (1 protein) not a true family |
| Protein automated matches [190457] (10 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [187598] (105 PDB entries) |
| Domain d1z9qa_: 1z9q A: [241125] automated match to d3c0ca_ |
PDB Entry: 1z9q (more details)
SCOPe Domain Sequences for d1z9qa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1z9qa_ b.34.2.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
drmaapraealfdftgnsklelnfkagdvifllsrinkdwlegtvrgatgifplsfvkil
kdfpee
Timeline for d1z9qa_: