Lineage for d1z9fa_ (1z9f A:)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1787538Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 1788689Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) (S)
  5. 1789742Family b.40.4.0: automated matches [191416] (1 protein)
    not a true family
  6. 1789743Protein automated matches [190576] (23 species)
    not a true protein
  7. 1789873Species Thermotoga maritima [TaxId:2336] [225895] (2 PDB entries)
  8. 1789874Domain d1z9fa_: 1z9f A: [241124]
    automated match to d2vw9a_

Details for d1z9fa_

PDB Entry: 1z9f (more details), 2.3 Å

PDB Description: Crystal structure of single stranded DNA-binding protein (TM0604) from Thermotoga maritima at 2.60 A resolution
PDB Compounds: (A:) Single-strand binding protein

SCOPe Domain Sequences for d1z9fa_:

Sequence, based on SEQRES records: (download)

>d1z9fa_ b.40.4.0 (A:) automated matches {Thermotoga maritima [TaxId: 2336]}
hmsffnkiiligrlvrdpeerytlsgtpvttftiavdrvprknapddaqttdffrivtfg
rlaefartyltkgrlvlvegemrmrrwetptgekrvspevvanvvrfmd

Sequence, based on observed residues (ATOM records): (download)

>d1z9fa_ b.40.4.0 (A:) automated matches {Thermotoga maritima [TaxId: 2336]}
hmsffnkiiligrlvrdpeerytltpvttftiavdrttdffrivtfgrlaefartyltkg
rlvlvegemrmrrkrvspevvanvvrfmd

SCOPe Domain Coordinates for d1z9fa_:

Click to download the PDB-style file with coordinates for d1z9fa_.
(The format of our PDB-style files is described here.)

Timeline for d1z9fa_: