SCOPe 2.07: Domain d1z9fa1: 1z9f A:1-108

Lineage for d1z9fa1 (1z9f A:1-108)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.40: OB-fold [50198] (17 superfamilies)
   barrel, closed or partly opened n=5, S=10 or S=8; greek-key

4. Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families)

5. Family b.40.4.0: automated matches [191416] (1 protein)
   not a true family

6. Protein automated matches [190576] (41 species)
   not a true protein

7. Species Thermotoga maritima [TaxId:2336] [225895] (2 PDB entries)

8. Domain d1z9fa1: 1z9f A:1-108 [241124]
   Other proteins in same PDB: d1z9fa2
   automated match to d2vw9a_

Details for d1z9fa1

PDB Entry: 1z9f, 2.3 Å

PDB Description: Crystal structure of single stranded DNA-binding protein (TM0604) from Thermotoga maritima at 2.60 A resolution

PDB Compounds: (A:) Single-strand binding protein

SCOPe Domain Sequences for d1z9fa1:

Sequence, based on SEQRES records:

>d1z9fa1 b.40.4.0 (A:1-108) automated matches {Thermotoga maritima [TaxId: 2336]}
msffnkiiligrlvrdpeerytlsgtpvttftiavdrvprknapddaqttdffrivtfgr
laefartyltkgrlvlvegemrmrrwetptgekrvspevvanvvrfmd

Sequence, based on observed residues (ATOM records):

>d1z9fa1 b.40.4.0 (A:1-108) automated matches {Thermotoga maritima [TaxId: 2336]}
msffnkiiligrlvrdpeerytltpvttftiavdrttdffrivtfgrlaefartyltkgr
lvlvegemrmrrkrvspevvanvvrfmd

Timeline for d1z9fa1:

• d1z9fa1 first appeared in SCOPe 2.04, called d1z9fa_
  
• d1z9fa1 appears in SCOPe 2.06