| Class a: All alpha proteins [46456] (289 folds) |
| Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily) multihelical; 3 layers or orthogonally packed helices |
Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) ![]() |
| Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins) |
| Protein automated matches [190059] (14 species) not a true protein |
| Species Bemisia tabaci [TaxId:7038] [255003] (1 PDB entry) |
| Domain d1z5xe_: 1z5x E: [241120] automated match to d3ixpd_ complexed with p1a, po4 |
PDB Entry: 1z5x (more details), 3.07 Å
SCOPe Domain Sequences for d1z5xe_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1z5xe_ a.123.1.1 (E:) automated matches {Bemisia tabaci [TaxId: 7038]}
pitpeqeelihrlvyfqneyehpspedikrivnaapeeenvaeerfrhiteitiltvqli
vefskrlpgfdkliredqiallkacssevmmfrmarrydaetdsilfatnqpytresytv
agmgdtvedllrfcrhmcamkvdnaeyalltaivifserpslsegwkvekiqeiyiealk
ayvenrrkpyattifakllsvltelrtlgnmnsetcfslklknrkvpsfleeiwdvv
Timeline for d1z5xe_: