Lineage for d1z5wa2 (1z5w A:247-440)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2958618Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2959091Superfamily d.79.2: Tubulin C-terminal domain-like [55307] (2 families) (S)
  5. 2960042Family d.79.2.0: automated matches [227141] (1 protein)
    not a true family
  6. 2960043Protein automated matches [226843] (9 species)
    not a true protein
  7. 2960061Species Human (Homo sapiens) [TaxId:9606] [224983] (3 PDB entries)
  8. 2960065Domain d1z5wa2: 1z5w A:247-440 [241119]
    Other proteins in same PDB: d1z5wa1
    automated match to d3cb2a2
    complexed with gtp, mg

Details for d1z5wa2

PDB Entry: 1z5w (more details), 3 Å

PDB Description: Crystal Structure of gamma-tubulin bound to GTP
PDB Compounds: (A:) Tubulin gamma-1 chain

SCOPe Domain Sequences for d1z5wa2:

Sequence, based on SEQRES records: (download)

>d1z5wa2 d.79.2.0 (A:247-440) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gymnndligliasliptprlhflmtgytplttdqsvasvrkttvldvmrrllqpknvmvs
tgrdrqtnhcyiailniiqgevdptqvhkslqrirerklanfipwgpasiqvalsrkspy
lpsahrvsglmmanhtsisslfertcrqydklrkreafleqfrkedmfkdnfdemdtsre
ivqqlideyhaatr

Sequence, based on observed residues (ATOM records): (download)

>d1z5wa2 d.79.2.0 (A:247-440) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gymnndligliasliptprlhflmtgytplttdsvrkttvldvmrrllqpknvmvstgtn
hcyiailniiqgevdptqvhkslqrirerklanfipwgpasiqvalsrkspyrvsglmma
nhtsisslfertcrqydklrkreafleqfrkedmfkdnfdemdtsreivqqlideyhaat
r

SCOPe Domain Coordinates for d1z5wa2:

Click to download the PDB-style file with coordinates for d1z5wa2.
(The format of our PDB-style files is described here.)

Timeline for d1z5wa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1z5wa1