Lineage for d1z5wa1 (1z5w A:2-246)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2107739Fold c.32: Tubulin nucleotide-binding domain-like [52489] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 6 strands, order 321456
  4. 2107740Superfamily c.32.1: Tubulin nucleotide-binding domain-like [52490] (2 families) (S)
    automatically mapped to Pfam PF00091
  5. 2107977Family c.32.1.0: automated matches [227136] (1 protein)
    not a true family
  6. 2107978Protein automated matches [226838] (4 species)
    not a true protein
  7. 2107997Species Human (Homo sapiens) [TaxId:9606] [224982] (3 PDB entries)
  8. 2108001Domain d1z5wa1: 1z5w A:2-246 [241118]
    Other proteins in same PDB: d1z5wa2
    automated match to d3cb2a1
    complexed with gtp, mg

Details for d1z5wa1

PDB Entry: 1z5w (more details), 3 Å

PDB Description: Crystal Structure of gamma-tubulin bound to GTP
PDB Compounds: (A:) Tubulin gamma-1 chain

SCOPe Domain Sequences for d1z5wa1:

Sequence, based on SEQRES records: (download)

>d1z5wa1 c.32.1.0 (A:2-246) automated matches {Human (Homo sapiens) [TaxId: 9606]}
preiitlqlgqcgnqigfefwkqlcaehgispeaiveefategtdrkdvffyqaddehyi
pravlldleprvihsilnspyaklynpeniylsehgggagnnwasgfsqgekihedifdi
idreadgsdslegfvlchsiaggtgsglgsyllerlndrypkklvqtysvfpnqdemsdv
vvqpynslltlkrltqnadclvvldntalnriatdrlhiqnpsfsqinqlvstimsastt
tlryp

Sequence, based on observed residues (ATOM records): (download)

>d1z5wa1 c.32.1.0 (A:2-246) automated matches {Human (Homo sapiens) [TaxId: 9606]}
preiitlqlgqcgnqigfefwkqlcaehgispeaitdrkdvffyqaddehyipravlldl
eprvihsilnspyaklynpeniylsgnnwasgfsqgekihedifdiidreadgsdslegf
vlchsiaggtgsglgsyllerlndrypkklvqtysvfpnqsdvvvqpynslltlkrltqn
adclvvldntalnriatdrlhiqnpsfsqinqlvstimsastttlryp

SCOPe Domain Coordinates for d1z5wa1:

Click to download the PDB-style file with coordinates for d1z5wa1.
(The format of our PDB-style files is described here.)

Timeline for d1z5wa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1z5wa2