Lineage for d1z5hb4 (1z5h B:490-780)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2725421Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2725422Superfamily a.118.1: ARM repeat [48371] (28 families) (S)
  5. 2726027Family a.118.1.26: ERAP1 C-terminal-like [254170] (3 proteins)
    Pfam PF11838; PubMed 15893768
    this is a repeat family; one repeat unit is 2xdt A:843-881 found in domain
  6. 2726032Protein Tricorn protease interacting factor F3 C-terminal domain [254385] (1 species)
  7. 2726033Species Thermoplasma acidophilum [TaxId:2303] [254818] (2 PDB entries)
  8. 2726036Domain d1z5hb4: 1z5h B:490-780 [241117]
    Other proteins in same PDB: d1z5ha1, d1z5ha2, d1z5ha3, d1z5hb1, d1z5hb2, d1z5hb3
    automated match to d1z1wa4
    complexed with so4, zn

    applies to all domains of a family if the common domain is composed of a different number of small repeating units

Details for d1z5hb4

PDB Entry: 1z5h (more details), 2.3 Å

PDB Description: crystal structures of the tricorn interacting factor f3 from thermoplasma acidophilum
PDB Compounds: (B:) Tricorn protease interacting factor F3

SCOPe Domain Sequences for d1z5hb4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z5hb4 a.118.1.26 (B:490-780) Tricorn protease interacting factor F3 C-terminal domain {Thermoplasma acidophilum [TaxId: 2303]}
datfsdvmghyrdlspldriglvddlfafllsghidpetyrqrirnffddedhnvitaiv
gqmeylrmlthafdddarafcrsrmqfltgkqdenlkialgrvsrlyvmvdesyaeemsk
lfkdfdsaepemrssiatayalvtgdlkgllekfrsvdrdedrvriisafgklksntdls
tvygmvekteikkqdmisffssaletlpgrefifanldriirlviryftgnrtasrtvem
mipvigldhpdaedivrnigsknismglakgiemlavnrklverirqtavk

SCOPe Domain Coordinates for d1z5hb4:

Click to download the PDB-style file with coordinates for d1z5hb4.
(The format of our PDB-style files is described here.)

Timeline for d1z5hb4: