SCOPe 2.05: Domain d1z5hb2: 1z5h B:171-414

Lineage for d1z5hb2 (1z5h B:171-414)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (18 families)

5. Family d.92.1.13: Zn aminopeptidase catalytic domain [64338] (5 proteins)
   adopts thermolysin-like fold

6. Protein Tricorn protease interacting factor F3 catalytic domain [254381] (1 species)

7. Species Thermoplasma acidophilum [TaxId:2303] [254814] (2 PDB entries)

8. Domain d1z5hb2: 1z5h B:171-414 [241115]
   Other proteins in same PDB: d1z5ha1, d1z5ha3, d1z5ha4, d1z5hb1, d1z5hb3, d1z5hb4
   automated match to d1z1wa2
   complexed with so4, zn

Details for d1z5hb2

PDB Entry: 1z5h, 2.3 Å

PDB Description: crystal structures of the tricorn interacting factor f3 from thermoplasma acidophilum

PDB Compounds: (B:) Tricorn protease interacting factor F3

SCOPe Domain Sequences for d1z5hb2:

Sequence; same for both SEQRES and ATOM records:

>d1z5hb2 d.92.1.13 (B:171-414) Tricorn protease interacting factor F3 catalytic domain {Thermoplasma acidophilum [TaxId: 2303]}
ryeyekyrdidlilaslkdirskypldmarksvefyenyfgipyalpkmhlisvpefgag
amenwgaitfreiymdiaensavtvkrnsanviaheiahqwfgdlvtmkwwndlwlnesf
atfmsyktmdtlfpewsfwgdffvsrtsgalrsdslknthpievdvrdpdeisqifdeis
ygkgasilrmiedyagyeefrkgiskylndhkfgnaegsdlwtaiedvsgkpvkrvmeyw
iknp

Timeline for d1z5hb2:

• d1z5hb2 first appeared in SCOPe 2.04
  
• d1z5hb2 appears in SCOPe 2.06
  
• d1z5hb2 appears in the current release, SCOPe 2.08