Lineage for d1z5ha3 (1z5h A:415-489)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2766973Superfamily b.1.30: Zn aminopeptidase insert domain [254133] (2 families) (S)
    same topology as (b.1.15.1)
  5. 2766974Family b.1.30.1: Zn aminopeptidase insert domain [254169] (3 proteins)
  6. 2766990Protein Tricorn protease interacting factor F3 insert domain [254383] (1 species)
  7. 2766991Species Thermoplasma acidophilum [TaxId:2303] [254816] (2 PDB entries)
  8. 2766993Domain d1z5ha3: 1z5h A:415-489 [241112]
    Other proteins in same PDB: d1z5ha1, d1z5ha2, d1z5ha4, d1z5hb1, d1z5hb2, d1z5hb4
    automated match to d1z1wa3
    complexed with so4, zn

Details for d1z5ha3

PDB Entry: 1z5h (more details), 2.3 Å

PDB Description: crystal structures of the tricorn interacting factor f3 from thermoplasma acidophilum
PDB Compounds: (A:) Tricorn protease interacting factor F3

SCOPe Domain Sequences for d1z5ha3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1z5ha3 b.1.30.1 (A:415-489) Tricorn protease interacting factor F3 insert domain {Thermoplasma acidophilum [TaxId: 2303]}
gypviklkrngrkitmyqtrfllngeeegrwpvpvnikkkdgverilledeasieadgli
kinadsagfyrvlyd

SCOPe Domain Coordinates for d1z5ha3:

Click to download the PDB-style file with coordinates for d1z5ha3.
(The format of our PDB-style files is described here.)

Timeline for d1z5ha3: